missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Complement C5 (aa 1302-1432) Control Fragment Recombinant Protein Product Code.: 30203592

Invitrogen™ Human Complement C5 (aa 1302-1432) Control Fragment Recombinant Protein

Product Code. 30203592
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203592

Brand: Invitrogen™ RP95393

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C5 (Complement C5) is a Protein Coding gene. Diseases associated with C5 include Complement Component 5 Deficiency and Eculizumab, Poor Response To. Among its related pathways are GPCR downstream signalling and Acquired partial lipodystrophy / Barraquer-Simons syndrome. Gene Ontology (GO) annotations related to this gene include signaling receptor binding and endopeptidase inhibitor activity. An important paralog of this gene is C3. This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01031
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 727
Name Human Complement C5 (aa 1302-1432) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias anaphylatoxin; anaphylatoxin C5; anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5; C5a; C5a anaphylatoxin; C5b; C5D; Complement C5; Complement C5 alpha chain; Complement C5 alpha' chain; Complement C5 beta chain; complement component 5; CPAMD4; ECLZB; Hc; He; hemolytic complement; prepro-C5; RGD1561905
Common Name Complement C5
Gene Symbol C5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human Complement C5 (aa 1302-1432) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.