All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (23)
- (12)
- (28)
- (116)
- (16)
- (193)
- (84)
- (123)
- (9)
- (6,017)
- (15)
- (31)
- (46)
- (221)
- (23,630)
- (562)
- (559)
- (562)
- (19)
- (1)
- (26,589)
- (98)
- (1,059)
- (1,760)
- (1)
- (28)
- (892)
- (10)
- (6)
- (36)
- (417)
- (271)
- (11,204)
- (6,712)
- (14)
- (16,518)
- (35,431)
- (162)
- (3,956)
- (8)
- (35,561)
- (24)
- (35)
- (5,325)
- (26)
- (24)
- (9)
- (88)
- (4)
- (10)
- (1)
- (835)
- (1)
- (5)
- (11)
- (8)
- (13)
- (727)
- (1)
- (2)
- (136)
- (13)
- (1,114)
- (31)
- (99)
- (112)
- (361)
- (28)
- (11)
- (762)
- (51)
- (25)
- (9)
- (5)
- (51,617)
- (78)
- (60,732)
- (26,706)
- (2,201)
- (371)
- (3)
- (22)
- (2,002)
- (2,201)
- (2,230)
- (2,167)
- (9)
- (1,986)
- (2,276)
- (2,196)
- (2,008)
- (2,726)
- (48)
- (27)
- (1)
- (90)
- (6)
- (1)
- (2)
- (1)
- (4)
- (5)
- (3,105)
- (1)
- (2,711)
- (2,717)
- (2,676)
- (2,678)
- (3,007)
- (2,691)
- (2,743)
- (2,741)
- (2,692)
- (2,692)
- (1,536)
- (2,811)
- (723)
- (723)
- (2,828)
- (1,511)
- (2,283)
- (7)
- (3)
- (368)
- (375)
- (368)
- (4)
- (2,375)
- (8)
- (1)
- (11,820)
- (3)
- (2,242)
- (2,206)
- (2,202)
- (1)
- (714)
- (172)
- (257)
- (219)
- (38)
- (209)
- (70,640)
- (1,323)
- (168)
- (5)
- (602)
- (106)
- (220)
- (18)
- (628)
- (24)
- (31)
- (145)
- (1)
- (1)
- (970)
- (7,033)
- (143)
- (3)
- (260)
- (1)
- (121)
- (743)
- (13)
- (7)
- (19)
- (2)
- (406)
- (248)
- (97)
- (3)
- (3)
- (1)
- (6)
- (8)
- (15)
- (166)
- (1,252)
- (182)
- (2)
- (20)
- (15)
- (173)
- (102)
- (130)
- (1,483)
- (56)
- (1,890)
- (43,889)
- (34,865)
- (3,623)
- (1,385)
Filtered Search Results
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C. Do not freeze. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Form | Purified |
| Isotype | IgG1 |
| Gene Accession No. | P23946 |
| Research Discipline | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Gene Symbols | CMA1 |
| Regulatory Status | RUO |
| Purification Method | Protein A or G purified |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Immunogen | BALB/C mice were injected with a purified human skin chymase. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | This reacts with mast cells distributed in skin, synovium, lung and heart. |
| Clone | CC1 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry |
| Form | Purified |
| Isotype | IgG1 κ |
| Research Discipline | Cardiovascular Biology |
| Concentration | 1 mg/mL |
| Antigen | Mast Cell Marker |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Immunohistochemistry 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MCG35 |
Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody
Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.
| Antigen | Desmin (Muscle Cell Marker) Ab-1 |
|---|---|
| Regulatory Status | IVD |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Immunohistochemistry (Paraffin) |
| Immunogen | Desmin from human muscle |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Muscle Biology |
| Clone | D33 |
Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™
Rat Monoclonal Antibody
| Content And Storage | Store at 4°C in the dark. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | Alexa Fluor 488 |
| Applications | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation |
| Form | Purified |
| Isotype | IgG2a κ |
| Research Discipline | Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers |
| Antigen | Panendothelial Cell Antigen |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Gene Alias | FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein |
| Gene ID (Entrez) | 84094 |
| Formulation | 50mM Sodium Borate |
| Immunogen | Mouse lymph node stromal cells. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | MECA-32 |
L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™
Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.
| Antigen | L1 Cell Adhesion Molecule Ab-1 |
|---|---|
| Regulatory Status | RUO |
| Target Species | Human |
| Host Species | Mouse |
| Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
| Immunogen | Homogenous suspension of 16 week human fetal brain |
| Classification | Monoclonal |
| Isotype | IgG2a κ |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | UJ127 |
Epredia™ Lab Vision™ CD3 (Early T-Cell Marker) Rabbit Monoclonal Antibody,
Stain normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues with Epredia™ CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody.
| Antigen | CD3 |
|---|---|
| Regulatory Status | IVD |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin) |
| Immunogen | A synthetic 13-mer peptide corresponding to aa 156-168 of the epsilon-chain of human CD3 protein |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | SP7 |
CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™
Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.
| Antigen | CD31 (Endothelial Cell Marker) |
|---|---|
| Regulatory Status | RUO |
| Purification Method | Tonsil |
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin) |
| Immunogen | Synthetic peptide corresponding to C-terminus of mouse CD31 protein |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
Epredia™ Lab Vision™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody
Obtain accurate, reproducible results in immunohistochemistry experiments with Epredia™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody.
| Antigen | CD79a/mb-1 (B-Cell Marker) |
|---|---|
| Regulatory Status | IVD |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin) |
| Immunogen | Synthetic peptide derived from N-terminal region of human CD79a protein |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | SP18 |
Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™
Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.
| Antigen | Renal Cell Carcinoma Marker (gp200) Ab-1 |
|---|---|
| Regulatory Status | IVD |
| Host Species | Mouse |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Immunogen | Microsomal fraction of human renal cortical tissue homogenate |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Research Discipline | Cancer and Tumor Biology |
| Clone | PN-15 |
Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 6G5/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Zebrafish |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunofluorescence |
| Form | Purified |
| Isotype | IgG1 |
| Research Discipline | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Concentration | 0.9 mg/mL |
| Antigen | Zebrafish Gut Secretory Cell Epitopes |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Dilution | Western Blot 1:200, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500 |
| Formulation | PBS |
| Immunogen | Lysate of zebrafish intestine |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIS 6G5/1 |
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Gene Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gene ID (Entrez) | 1215 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 2O4P8 |
Thy-1 cell surface antigen, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a full-length human THY1 protein.