missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM16K Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4200.00 NOK - 5776.05 NOK
Specifications
| Antigen | TMEM16K |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18324362
|
Bio-Techne
NBP3-17446-25UL |
25 μg |
 4440.00 NOK 4200.00 NOK / 25µL Save 240.00 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18312852
|
Bio-Techne
NBP3-17446-100UL |
100 μg |
6110.00 NOK 5776.05 NOK / 100µL Save 333.95 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM16K Polyclonal antibody specifically detects TMEM16K in Human samples. It is validated for ImmunofluorescenceSpecifications
| TMEM16K | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| anoctamin 10, FLJ10375, MGC47890, Transmembrane protein 16KTMEM16Kanoctamin-10 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 55129 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title