missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TMEM16K Rabbit anti-Human, Polyclonal, Novus Biologicals™

TMEM16K Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18312852
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
Product Code. Quantity unitSize
18312852 100 μg 100µL
18324362 25 μg 25µL
2 options
This item is not returnable. View return policy

Product Code. 18312852

Brand: Bio-Techne NBP317446100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TMEM16K Polyclonal antibody specifically detects TMEM16K in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen TMEM16K
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias anoctamin 10, FLJ10375, MGC47890, Transmembrane protein 16KTMEM16Kanoctamin-10
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55129
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.