missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sonic Hedgehog/Shh Rabbit anti-Human, Mouse, Rat, Clone: 8T4D3, Novus Biologicals™
Rabbit Monoclonal Antibody
1760.00 NOK - 4590.00 NOK
Specifications
| Antigen | Sonic Hedgehog/Shh |
|---|---|
| Clone | 8T4D3 |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18392342
|
Bio-Techne
NBP3-15454-20UL |
20 μg |
1760.00 NOK
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18325864
|
Novus Biologicals
NBP3-15454-100UL |
100 μg |
4590.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sonic Hedgehog/Shh Monoclonal antibody specifically detects Sonic Hedgehog/Shh in Human, Mouse, Rat samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| Sonic Hedgehog/Shh | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog/Shh (Q15465). PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 8T4D3 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Biologically Active Proteins, Neuroscience, Sensory Systems, Stem Cell Signaling Pathway, Stem Cells, Vision | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 6469 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title