missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sonic Hedgehog/Shh Rabbit anti-Human, Mouse, Rat, Clone: 8T4D3, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-15454-100UL
This item is not returnable.
View return policy
Description
Sonic Hedgehog/Shh Monoclonal antibody specifically detects Sonic Hedgehog/Shh in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
| Sonic Hedgehog/Shh | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunofluorescence | |
| 8T4D3 | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog/Shh (Q15465). PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG | |
| 100 μg | |
| Biologically Active Proteins, Neuroscience, Sensory Systems, Stem Cell Signaling Pathway, Stem Cells, Vision | |
| 6469 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction