missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFMBT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48652
This item is not returnable.
View return policy
Description
SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| SFMBT1 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 51460 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering