missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFMBT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
3571.05 NOK - 4908.75 NOK
Specifications
| Antigen | SFMBT1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18649626
|
Novus Biologicals
NBP2-48652 |
0.1 mL |
5190.00 NOK 4908.75 NOK / 0.10mL Save 281.25 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669957
|
Novus Biologicals
NBP2-48652-25ul |
25 μL |
3780.00 NOK 3571.05 NOK / 25µL Save 208.95 NOK 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SFMBT1 Polyclonal antibody specifically detects SFMBT1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| SFMBT1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 51460 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title