missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ROD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09994-100UL
This item is not returnable.
View return policy
Description
ROD1 Polyclonal specifically detects ROD1 in Human samples. It is validated for Western Blot.
Specifications
ROD1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe) | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ROD1 (NP_001157260.1). Peptide sequence RATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSA | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9991 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction