missing translation for 'onlineSavingsMsg'
Learn More

RABIF Recombinant Protein, Abnova

Brand:  Abnova H00005877-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140002

  • 5420.23 NOK / 25µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH18488
Solution
5877
RABIF (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RABIF
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
39.27
8
Glutathione Sepharose 4 Fast Flow
25 ug
MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
MSS4/RASGFR3/RASGRF3
RABIF
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates