missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ LTBP1 (Human) Recombinant Protein (Q01)
Human LTBP1 partial ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00004052-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Theoretical M.W.: 36.52kDa
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
NP_000618 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
36.52 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS | |
MGC163161 | |
LTBP1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, ELISA, Protein Array, Western Blot | |
4052 | |
LTBP1 (Human) Recombinant Protein (Q01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
LTBP1 | |
Human | |
Recombinant | |
Solution |