missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ LTBP1 (Human) Recombinant Protein (Q01)
Human LTBP1 partial ORF recombinant protein with GST-tag at N-terminal
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | NP_000618 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 4052 |
Molecular Weight (g/mol) | 36.52 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16137471
|
Abnova™
H00004052-Q01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 27-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16147471
|
Abnova™
H00004052-Q01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 27-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Theoretical M.W.: 36.52kDa
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
NP_000618 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
36.52 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
LTBP1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, ELISA, Protein Array, Western Blot | |
4052 | |
LTBP1 (Human) Recombinant Protein (Q01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
CPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS | |
MGC163161 | |
LTBP1 | |
Wheat Germ (in vitro) | |
GST |