missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KHSRP (Human) Recombinant Protein

Human KHSRP partial ORF ( NP_003676, 151 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00008570-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138855

  • 3602.46 NOK / 10µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM
Specifications

Specifications

NP_003676
KH-type splicing regulatory protein
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KHSRP
GST
8570
Wheat germ expression system
10 μg
FBP2, FUBP2, KSRP, MGC99676
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates