missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KHSRP (Human) Recombinant Protein

Name: Abnova&trade; KHSRP (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16138855
Price: 4115.00 EUR

Human KHSRP partial ORF ( NP_003676, 151 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00008570-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16138855

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM

Specifications

Accession Number	NP_003676
Name	KH-type splicing regulatory protein
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	KHSRP
Protein Tag	GST

Gene ID (Entrez)	8570
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	FBP2, FUBP2, KSRP, MGC99676
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description