missing translation for 'onlineSavingsMsg'
Learn More

IL1B (Human) Recombinant Protein (P01), Abnova™

Human IL1B full-length ORF ( AAH08678, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal

Brand:  Abnova H00003553-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136731

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

bullets1 (begin)Molecular weight: 50.33kDa
Preparation method:italics (begin) in vitroitalics (end) wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Bluebullets1 (end)

Best use within three months from the date of receipt of this protein

Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array

Specifications

Specifications

AAH08678
3553
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IL1B
Wheat Germ (in vitro)
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
IL1B (Human) Recombinant Protein (P01)
10 ug
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
IL-1/IL1-BETA/IL1F2
IL1B
GST
Videos
SDS
Documents
Certificates

For Research Use Only