Learn More
Abnova™ IL1B (Human) Recombinant Protein (P01)
Human IL1B full-length ORF ( AAH08678, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | AAH08678 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Gene ID (Entrez) | 3553 |
Name | IL1B (Human) Recombinant Protein (P01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16136731
|
Abnova™
H00003553-P01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 20-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16146731
|
Abnova™
H00003553-P01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 20-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
bullets1 (begin)Molecular weight: 50.33kDa
Preparation method:italics (begin) in vitroitalics (end) wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Bluebullets1 (end)
Best use within three months from the date of receipt of this protein
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
Specifications
AAH08678 | |
3553 | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | |
IL-1/IL1-BETA/IL1F2 | |
IL1B | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
IL1B (Human) Recombinant Protein (P01) | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IL1B | |
Wheat Germ (in vitro) |
For Research Use Only