Learn More
Abnova™ IL1B (Human) Recombinant Protein (P01)
Human IL1B full-length ORF ( AAH08678, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00003553-P01.25ug
Additional Details : Weight : 0.00010kg
Description
Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
bullets1 (begin)Molecular weight: 50.33kDa
Preparation method:italics (begin) in vitroitalics (end) wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Quality Control Testing:12.5% SDS-PAGE stained with Coomassie Bluebullets1 (end)
Best use within three months from the date of receipt of this protein
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
Specifications
AAH08678 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
56.33 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS | |
IL-1/IL1-BETA/IL1F2 | |
IL1B | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
3553 | |
IL1B (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IL1B | |
Human | |
Recombinant | |
Solution |
For Research Use Only