missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF323 Partial ORF (NP_112161.2, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064288-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139596

  • 6270.00 NOK / 25µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ZNF323 is a member of the subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]).[supplied by OMIM]

Sequence: MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRR
Specifications

Specifications

NP_112161.2
Liquid
64288
ZNF323 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23407/ZNF20-Lp/ZNF310P/dJ874C20.2
ZNF323
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRR
RUO
ZNF323
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers