Learn More
Abnova™ Human ZMPSTE24 Partial ORF (NP_005848.2, 402 a.a. - 475 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010269-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the peptidase M48A family. The encoded protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in this gene have been associated with mandibuloacral dysplasia and restrictive dermopathy. [provided by RefSeq]
Sequence: VLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQHSpecifications
NP_005848.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.88kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
VLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH | |
RUO | |
ZMPSTE24 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
10269 | |
ZMPSTE24 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FACE-1/FACE1/FLJ14968/STE24/Ste24p | |
ZMPSTE24 | |
Recombinant | |
wheat germ expression system |