missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SEMA5A Partial ORF (NP_003957, 393 a.a. - 499 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009037-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139785

  • 3602.46 NOK / 10µg

Estimated Shipment: 20-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Members of the semaphorin protein family, such as SEMA5A, are involved in axonal guidance during neural development (Adams et al., 1996 [PubMed 8817451]).[supplied by OMIM]

Sequence: PSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGA
Specifications

Specifications

NP_003957
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGA
RUO
SEMA5A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9037
SEMA5A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12815/SEMAF/semF
SEMA5A
Yes
Videos
SDS
Documents
Certificates