missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARPM2 Partial ORF (NP_536356, 209 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00140625-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141947

  • 5420.23 NOK / 25µg

Estimated Shipment: 30-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq]

Sequence: DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Specifications

Specifications

NP_536356
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
RUO
ACTRT2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
140625
ARPM2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARPM2/ARPT2/Arp-T2/FLJ25424/HARPM2
ACTRT2
Yes
Videos
SDS
Documents
Certificates