missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
Brand: Abnova™ P0001.10ug
Additional Details : Weight : 0.00010kg
Specifications
| AAB37352 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
| 10 µg | |
| Store at -80°C Aliquot to avoid repeated freezing and thawing | |
| Human |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Wheat Germ (in vitro) | |
| MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |