missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GST Protein

GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.

Brand:  Abnova™ P0001.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141044

  • 3865.09 NOK / 10µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

AAB37352
Antibody Production,Array,ELISA,Western Blot
12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Human
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
10 µg
Store at -80°C Aliquot to avoid repeated freezing and thawing
Videos
SDS
Documents
Certificates