missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GST Protein
GST full-length ORF ( AAB37352, 1 a.a. - 242 a.a.) protein.
4715.00 NOK - 7175.00 NOK
Specifications
Accession Number | AAB37352 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
Source | Wheat Germ (in vitro) |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16141044
|
Abnova™
P0001.10UG |
10 µg |
4715.00 NOK
10µg |
Estimated Shipment: 27-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16151044
|
Abnova™
P0001.25UG |
25 µg |
7175.00 NOK
25µg |
Estimated Shipment: 27-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
AAB37352 | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer | |
Wheat Germ (in vitro) | |
MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
Antibody Production, Protein Array, ELISA, Western Blot | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C Aliquot to avoid repeated freezing and thawing | |
Human |