missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GNGT1 (Human) Recombinant Protein
Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00002792-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
Specifications
| AAH29367 | |
| guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GNGT1 | |
| GST |
| 2792 | |
| Wheat germ expression system | |
| 25 μg | |
| GNG1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |