missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GNGT1 (Human) Recombinant Protein
Human GNGT1 full-length ORF ( AAH29367, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
4115.00 NOK - 6245.00 NOK
Specifications
| Accession Number | AAH29367 |
|---|---|
| Gene ID (Entrez) | 2792 |
| Name | guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16125601
|
Abnova™
H00002792-P01.10UG |
10 μg |
4115.00 NOK
10µg |
Estimated Shipment: 13-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16135601
|
Abnova™
H00002792-P01.25UG |
25 μg |
6245.00 NOK
25µg |
Estimated Shipment: 13-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
Specifications
| AAH29367 | |
| guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| GNG1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 2792 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GNGT1 | |
| GST |