missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CXCL1 (Human) Recombinant Protein (P01)

Name: Abnova&trade; CXCL1 (Human) Recombinant Protein (P01)
Brand: Abnova&trade;
SKU: 16125791
Price: 4115.00 EUR

Human CXCL1 full-length ORF with GST-tag at N-terminal

Marca: Abnova™ H00002919-P01.10ug

Detalles adicionales : Weight : 0.00010kg

Código de producto. 16125791

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descripción

Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal

Theoretical MW: 37.51kDa
Preparation Method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Especificaciones

Accession Number	AAH11976
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	37.51
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Gene Alias	FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1
Gene Symbol	CXCL1
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	2919
Name	CXCL1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	CXCL1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Sugerencias de productos

Descripción