Learn More
Abnova™ CXCL1 (Human) Recombinant Protein (P01)
Human CXCL1 full-length ORF with GST-tag at N-terminal
Marca: Abnova™ H00002919-P01.10ug
Detalles adicionales : Weight : 0.00010kg
Descripción
Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal
- Theoretical MW: 37.51kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Especificaciones
AAH11976 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
37.51 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN | |
FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1 | |
CXCL1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
2919 | |
CXCL1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CXCL1 | |
Human | |
Recombinant | |
Solution |