missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CXCL1 (Human) Recombinant Protein (P01)
Human CXCL1 full-length ORF with GST-tag at N-terminal
4115.00 NOK - 6245.00 NOK
Specifications
Accession Number | AAH11976 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 2919 |
Molecular Weight (g/mol) | 37.51 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16125791
|
Abnova™
H00002919-P01.10UG |
10 ug |
4115.00 NOK
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16135791
|
Abnova™
H00002919-P01.25UG |
25 ug |
6245.00 NOK
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal
- Theoretical MW: 37.51kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
AAH11976 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
37.51 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CXCL1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
2919 | |
CXCL1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN | |
FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1 | |
CXCL1 | |
Wheat Germ (in vitro) | |
GST |