missing translation for 'onlineSavingsMsg'
Learn More

CXCL1 (Human) Recombinant Protein (P01), Abnova

Human CXCL1 full-length ORF with GST-tag at N-terminal

Brand:  Abnova H00002919-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135791

  • 5420.23 NOK / 25µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal

  • Theoretical MW: 37.51kDa
  • Preparation Method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

Specifications

AAH11976
Solution
2919
CXCL1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CXCL1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
37.51
8
Glutathione Sepharose 4 Fast Flow
25 ug
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1
CXCL1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates