missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4260.00 NOK
Specifications
| Antigen | BP1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
BP1 Polyclonal specifically detects BP1 in Human samples. It is validated for Western Blot.Specifications
| BP1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Adaptive Immunity, Cancer, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Neuronal Cell Markers, Stem Cell Markers | |
| PBS buffer, 2% sucrose | |
| 1748 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Beta protein 1, BP1distal-less homeo box 7, distal-less homeobox 4, DLX7distal-less homeo box 9, DLX8DLX9, homeobox protein DLX-4, Homeobox protein DLX-7, Homeobox protein DLX-8 | |
| The immunogen is a synthetic peptide directed towards the middle region of human BP1 (NP_001925). Peptide sequence ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto