missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10328-100UL
This item is not returnable.
View return policy
Description
BP1 Polyclonal specifically detects BP1 in Human samples. It is validated for Western Blot.
Specifications
| BP1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Beta protein 1, BP1distal-less homeo box 7, distal-less homeobox 4, DLX7distal-less homeo box 9, DLX8DLX9, homeobox protein DLX-4, Homeobox protein DLX-7, Homeobox protein DLX-8 | |
| The immunogen is a synthetic peptide directed towards the middle region of human BP1 (NP_001925). Peptide sequence ERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVS | |
| 100 μg | |
| Adaptive Immunity, Cancer, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Neuronal Cell Markers, Stem Cell Markers | |
| 1748 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Übermitteln Sie eine inhaltliche Korrektur