Filtered Search Results
Search results for "protein"
Thermo Scientific™ Pierce™ BCA Protein Assay Kits
The Pierce BCA Protein Assay Kit is a high-precision, detergent-compatible protein assay for determination of protein concentration. Pierce BCA reagents provide accurate determination of protein concentration with most sample types encountered in protein research.
Assay | BCA Assay |
---|---|
For Use With (Equipment) | Spectrophotometer, Microplate Reader |
Product Type | Protein Quantitation Assay |
For Use With (Application) | Solution-based Detection, Absorbance |
Product Line | Pierce™ |
Detection Method | Colorimetric |
Invitrogen™ Qubit™ Protein and Protein Broad Range (BR) Assay Kits
Achieve sensitive detection of protein, and low protein-to-protein variation, with the Qubit Protein and Protein BR Assay Kits for fluorescence-based protein quantitation assays.
Product Line | Qubit™ |
---|---|
Detection Method | Fluorescence |
Purity or Quality Grade | >95% |
---|---|
Conjugate | Unconjugated |
Specific Reactivity | Human |
Form | Liquid |
Molecular Weight (g/mol) | 8.7 kD |
Gene Symbol | CXCL10 |
Endotoxin Concentration | 0.01 ng/ μg cytokine |
Storage Requirements | -20°C |
Concentration | 200 μg/mL |
For Use With (Application) | Control,ELISA,Western Blot |
Source | E. coli |
Name | Human CXCL10 (aa 22-98) |
Accession Number | P02778 |
Regulatory Status | RUO |
Gene Alias | 10 kDa interferon gamma-induced protein; 10 kDa interferon-gamma induced protein precursor; C Cmotif chemokine; C x C motif chemokine; C7; CC motif chemokine; CCmotif chemokine; chemokine (C-X-C motif) ligand 10; chemokine C-X-C motif ligand 10; chemokine CXC-like protein; Crg2; crg-2; CXC; CXC chemokine; CXC motif chemokine; C-X-C motif chemokine 10; C-X-C motif chemokine 10-like protein; C-X-C motif chemokine ligand 10; CXCL; CXCL10; CXCL10(1-73); gamma interferon inducible protein 10; gamma IP10; gamma-IP10; gIP-10; H-IP-10; IFI10; Inp10; interferon activated gene 10; interferon-gamma induced protein CRG-2; interferon-gamma-induced protein CRG-2; interferon-gamma-inducible protein 10; interferon-gamma-inducible protein-10; interferon-inducible cytokine IP-10; interferon-inducible protein 10; IP10; IP-10; M-IP-10; Mob1; mob-1; protein 10 from interferon (gamma)-induced cell line; protein Mob-1; Scyb10; similar to Small inducible cytokine B10 precursor (CXCL10) (10 kDa interferon-gamm |
Gene ID (Entrez) | 3627 |
Formulation | PBS with no preservative |
Recombinant | Recombinant |
Gibco™ Human CCL2 (MCP-1) Recombinant Protein
Recombinant MCP-1 (MCAF) is a bioactive protein intended for use in cell culture applications
Shipping Condition | Wet Ice |
---|---|
Protein Family | Chemokines & Receptors |
Content And Storage | Store in refrigerator (2–8°C). |
Purity or Quality Grade | 98 % |
Form | Lyophilized |
Molecular Weight (g/mol) | 8 kDa |
Endotoxin Level | < 0.1 ng/μg |
Expression System | E. coli |
For Use With (Application) | Cell Culture |
Protein Subtype | MCP⁄MCAF Chemokines |
Purification Method | Sequential Chromatography |
Gene Alias | MCP-1 (MCAF) |
Protein Form | Recombinant, Ligand |
Gene ID (Entrez) | 6347 |
Classification | Carrier-Free |
Research Category | Signal Transduction, Inflammation, Bone Research |
Species | Human |
Product Line | Gibco™ |
Thermo Scientific™ PageRuler™ Plus Prestained Protein Ladder, 10 to 250 kDa
Mixture of 9 blue-, orange- and green-stained proteins (10 to 250kDa) used as size standards in protein electrophoresis (SDS-PAGE) and Western blotting.
Number of Markers | 9 |
---|---|
Product Type | Protein Ladder |
Molecular Weight (g/mol) | 250, 130, 100, 70, 55, 35, 25, 15, 10 kDa |
Ready to Load | Yes |
Stain Type | 3 colors: Blue, Orange, Green |
Size Range | 10 to 250 kDa |
Product Line | PageRuler™ |
Detection Method | Colorimetric, NIR Fluorescence (700 nm), RGB Fluorescence (555 nm) |
enQuireBio™ Recombinant West Nile Virus WNV Envelope Protein
A cDNA sequence encoding the WNV Envelope was constructed and used to recombinantly synthesize the protein.
Buffer | (1 mg/ml) 20mM Phosphate buffer pH 7.5. |
---|---|
Regulatory Status | Research Use Only |
Purity or Quality Grade | Protein is >95% pure as determined by SDS-PAGE. |
Product Type | Recombinant Protein |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Sequence | MQLKGTTYGV CSKAFKFLGT PADTGHGTVV LELQYTGTDG PCKVPISSVA SLNDLTPVGR LVTVNPFVSV ATANAKVLIE LEPPFGDSYI VVGRGEQQIN HHWHKSGSSI GKAFTTTLKG ALEMQLKGTT YGVCSKAFKF LGTPADTGHG TVVLELQYTG TDGPCKVPIS SVASLNDLTP VGRLVTVNPFV SVATANAKVL IELEPPFGDS YIVVGRGEQQI NHHWHKSGSS IGKAFTTTLK GALEMQLKGT TYGVCSKAFK FLGTPADTGH GTVVLELQYT GTDGPCKVPI SSVASLNDLT PVGRLVTVNP FVSVATANAK VLIELEPPFG DSYIVVGRGE QQINHHWHKS GSSIGKAFTT TLKGALEHHH HHH |
Cross Reactivity | West Nile Virus |
Protein Tag | His |
Species | E. coli |
Name | West Nile Virus WNV Envelope Protein |
Thermo Scientific™ Pierce™ Protein Concentrators PES, 3K or 5K MWCO, 0.5–100 mL
Thermo Scientific Pierce Protein Concentrators PES are easy-to-use centrifugal devices that provide fast processing and excellent recovery of proteins with MWCO values of 3K and 5K, in 0.5–100 mL sample volumes.
Shipping Condition | Room Temperature |
---|---|
Disposable | Single-use |
Material (Membrane) | PES |
Purification Target | Protein |
Abnova™ Human MAPK3 Partial ORF (AAH13992, 279 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Form | Liquid |
---|---|
Common Name | MAPK3 |
Molecular Weight (g/mol) | 36.74kDa |
Gene Symbol | MAPK3 |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Expression System | wheat germ expression system |
For Use With (Application) | Antibody Production,ELISA,Protein Array,Western Blot |
Name | MAPK3 (Human) Recombinant Protein (Q01) |
Accession Number | AAH13992 |
Regulatory Status | RUO |
Gene Alias | ERK1/HS44KDAP/HUMKER1A/MGC20180/P44ERK1/P44MAPK/PRKM3 |
Gene ID (Entrez) | 5595 |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Immunogen | NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Protein Tag | GST |
Species | Wheat Germ (in vitro) |
Recombinant | Recombinant |
Thermo Scientific™ Ionic Detergent Compatibility Reagent for Pierce™ 660nm Protein Assay Reagent
Red-to-green (A660nm), ready-to-use, detergent- and reducing agent-compatible assay reagent to measure total protein concentration vs. protein standard.
Invitrogen™ Dynabeads™ Protein G for Immunoprecipitation
Dynabeads Protein G beads are uniform, 2.8-μm superparamagnetic beads with recombinant Protein G (∼17 kDa) covalently coupled to the surface.
Shipping Condition | Ambient temperature |
---|---|
Content And Storage | Store at 2–8°C. |
Purity or Quality Grade | For Research Use Only |
Description | Recombinant Protein G covalently bound to Dynabeads |
Surface Functionality | Protein G |
Isolation Technology | Magnetic Beads |
Material | Polystyrene |
Concentration | 30 mg/mL |
High-throughput Compatibility | High-throughput Compatible |
For Use With (Application) | Immunoprecipitation |
Ligand Type | Protein G |
Format | Beads in suspension |
Contents | Dynabeads Protein G are supplied in PBS, pH 7.4 w/0.01% Tween-20, 0.09% NaN3 |
Preservative | 0.02% NaN3 |
For Use With (Equipment) | KingFisher™ Sample Purification System, DynaMag™ magnets |
Product Type | Superparamagnetic Beads |
Diameter (Metric) | 2.8 μm |
Purification Target | Antibodies |
Certifications/Compliance | ISO9001 and ISO13485 |
Uniformity | Monosized 2.8 mm (CV <5%) |
Product Line | Dynabeads™ |
Eppendorf™ Polypropylene Protein LoBind Microcentrifuge Tube
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Store peptide, antibody or virus samples in these LoBind microcentrifuge tubes. Eppendorf™ Polypropylene Protein LoBind Microcentrifuge Tubes are ideal for work in protein research, mass spectrometry and protein array sample preparation.
Material | Polypropylene |
---|---|
No. per Pack | 100 Tubes (2 bags of 50) |
For Use With (Application) | Protein LoBind consumables are best suited for work in protein research, mass spectrometry, protein array sample preparation, and storage of peptide, antibody or virus samples |
Sterility | PCR Clean |
Closure Material | Polypropylene |