accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (163)
  • (54)

special programs

  • (40)

Quantity

  • (3)
  • (103)
  • (37)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)

Applications

  • (3)
  • (10)
  • (18)
  • (42)
  • (3)
  • (1)
  • (12)
  • (1)
  • (10)
  • (28)
  • (84)
  • (1)
  • (4)
  • (2)
  • (45)

Conjugate

  • (2)
  • (9)
  • (11)
  • (5)
  • (10)
  • (3)
  • (10)
  • (6)
  • (11)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (4)
  • (1)
  • (5)
  • (4)
  • (4)
  • (1)
  • (4)
  • (49)
  • (4)
  • (3)
  • (4)

Regulatory Status

  • (164)

Target Species

  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (146)
  • (1)
  • (19)
  • (3)
  • (1)
  • (1)
  • (13)
  • (4)
  • (1)
  • (10)

Classification

  • (138)
  • (25)

Form

  • (163)

Host Species

  • (1)
  • (77)
  • (79)
  • (6)

Isotype

  • (55)
  • (41)
  • (14)
  • (17)
  • (12)
  • (15)
  • (9)

For Use With (Application)

  • (5)
  • (5)
  • (5)
  • (1)
  • (5)
1 – 15 of 208 results
4

ErbB2/Her2 Antibody (rERBB2/9401), Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Store at 4°C.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG2b κ
Research Discipline Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Concentration 0.2 mg/mL
Antigen ErbB2/Her2
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunohistochemistry-Paraffin : 1-2 μg/mL
Gene Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Gene ID (Entrez) 2064
Formulation 10 mM PBS with 0.05% BSA
Immunogen Recombinant fragment (around aa1155-1255) of human ErbB2/Her2 protein (exact sequence is proprietary)
Classification Monoclonal
Primary or Secondary Primary
Clone rERBB2/9401
5

SPARC-like 1/SPARCL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG
Research Discipline Cancer
Antigen SPARC-like 1/SPARCL1
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution ELISA 1:5000-1:10000
Gene Alias hevin, High endothelial venule protein, MAST 9, MAST9, PIG33, proliferation-inducing protein 33, SC1, SPARC-like 1 (hevin), SPARC-like 1 (mast9, hevin), SPARC-like protein 1
Gene ID (Entrez) 8404
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Mouse SPARC-like 1/SPARCL1 (Accession#: EDL20231.1; Met1-Phe650)
Classification Polyclonal
Primary or Secondary Primary
6

Novus Biologicals™ pCLNDX Retrovirus Expression Vector

pCLNDX expression vector is part of RetroMax system designed for maximal virus titer in 293 cells

7

Novus Biologicals™ FoxP3

Foxp3, human (full length cDNA) in PCLXSN Retroviral expression vector

8

Novus Biologicals™ ROR alpha Plasmid

For expression of hROR alpha protein in mammalian cells, induction of G6Pase promoter activity

10

NCKAP1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline Apoptosis
Antigen NCKAP1
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000
Gene Alias FLJ11291, HEM2p125Nap1, KIAA0587, Membrane-associated protein HEM-2, MGC8981, NAP 1, NAP125, NAP1Nap1, NCK-associated protein 1
Gene ID (Entrez) 10787
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1). MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC
Classification Polyclonal
Primary or Secondary Primary
12

Human Perforin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. P14222
Antigen Perforin
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Dilution Immunohistochemistry 5-25 ug/mL
Gene Alias Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1
Gene ID (Entrez) 5551
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2771C
13

Human Desmocollin-1 Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. Q08554
Antigen Desmocollin-1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Immunohistochemistry 3-25 ug/mL
Gene Alias cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1
Gene ID (Entrez) 1823
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2906A
14

Human FGFR1 alpha (IIIc) Alexa Fluor™ 647-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody