accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (163)
  • (54)

special programs

  • (40)

Quantity

  • (3)
  • (103)
  • (37)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)

Applications

  • (3)
  • (10)
  • (18)
  • (42)
  • (3)
  • (1)
  • (12)
  • (1)
  • (10)
  • (28)
  • (84)
  • (1)
  • (4)
  • (2)
  • (45)

Conjugate

  • (2)
  • (9)
  • (11)
  • (5)
  • (10)
  • (3)
  • (10)
  • (6)
  • (11)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (4)
  • (1)
  • (5)
  • (4)
  • (4)
  • (1)
  • (4)
  • (49)
  • (4)
  • (3)
  • (4)

Regulatory Status

  • (164)

Target Species

  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (146)
  • (1)
  • (19)
  • (3)
  • (1)
  • (1)
  • (13)
  • (4)
  • (1)
  • (10)

Classification

  • (138)
  • (25)

Form

  • (163)

Host Species

  • (1)
  • (77)
  • (79)
  • (6)

Isotype

  • (55)
  • (41)
  • (14)
  • (17)
  • (12)
  • (15)
  • (9)

For Use With (Application)

  • (5)
  • (5)
  • (5)
  • (1)
  • (5)
1 – 15 of 208 results
4

Human Perforin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. P14222
Antigen Perforin
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Dilution Immunohistochemistry 5-25 ug/mL
Gene Alias Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1
Gene ID (Entrez) 5551
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2771C
11

SARS-CoV-2 Spike RBD Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species SARS-CoV-2
Host Species Mouse
Conjugate Unconjugated
Applications Blocking Assay,Neutralization,Immunocytochemistry
Form Purified
Isotype IgG1
Gene Accession No. YP_009724390.1
Antigen Spike RBD
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Blockade of Receptor-ligand Interaction, Neutralization, Immunocytochemistry 8-25 ug/mL
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Human embryonic kidney cell, HEK293-derived sars-cov-2 Spike S1 Subunit protein, Val16-Pro681, Accession # YP_009724390.1
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 1049417
12

Human alpha 2-Macroglobulin Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG1
Antigen alpha 2-Macroglobulin
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias A2M, alpha 2Macroglobulin, Alpha-2-M, alpha-2-macroglobulin, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5, CPAMD5, CPAMD5DKFZp779B086, FWP007, S863-7
Gene ID (Entrez) 2
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Human plasma-derived alpha 2-Macroglobulin
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 257303
13

Novus Biologicals™ alpha Satellite Repeat Primer

alpha SAT primer for PCR in chromatin precipitation

Content And Storage Store at –20°C. Avoid Free/Thaw Cycles
Product Type alpha Satellite Repeat Primer
For Use With (Application) Chromatin Immunoprecipitation
15

CYTB Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Antigen CYTB
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin
Gene Alias cytochrome b, MTCYB, MT-CYB mitochondrially encoded cytochrome b
Gene ID (Entrez) 4519
Formulation PBS with 50% glycerol, pH7.3.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CYTB (YP_003024038.1). RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL
Classification Polyclonal
Primary or Secondary Primary