All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (3)
- (9)
- (10)
- (2)
- (32)
- (56)
- (1)
- (4)
- (4)
- (1)
- (126)
- (263)
- (186)
- (1,609)
- (5)
- (71)
- (1)
- (1,554)
- (1)
- (58)
- (1)
- (1)
- (2)
- (92)
- (4)
- (3)
- (5)
- (1)
- (6,163)
- (791)
- (5,591)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (6,351)
- (1)
- (1)
- (1)
- (2)
- (17)
- (3)
- (2)
- (755)
- (5,600)
- (5)
- (9)
- (9)
- (5)
- (1)
- (5)
- (109)
- (28)
- (1)
- (7)
- (33)
- (1)
- (6,168)
- (3)
- (2)
- (1)
- (1)
- (1)
Filtered Search Results
Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TMBIM1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ L-Selectin (CD62L) Chimeric Recombinant Rabbit Monoclonal Antibody (DREG-56)
Rabbit Recombinant Monoclonal Antibody
Invitrogen™ L-Selectin (CD62L) Recombinant Mouse Monoclonal Antibody (DREG-56)
Mouse Recombinant Monoclonal Antibody
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Antigen | ZNF879 |
| Gene Symbols | ZNF879 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 77 kDa |
| Gene Alias | zinc finger protein 879 |
| Gene ID (Entrez) | 345462 |
| Immunogen | Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_848653 |
| Antigen | ZNF680 |
| Gene Symbols | ZNF680 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 62 kDa |
| Gene Alias | FLJ90430, zinc finger protein 680 |
| Gene ID (Entrez) | 340252 |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_690873 |
| Antigen | ZNF548 |
| Gene Symbols | ZNF548 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 63 kDa |
| Gene Alias | FLJ32932, zinc finger protein 548 |
| Gene ID (Entrez) | 147694 |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF548. Peptide sequence VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQN. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | NP_872337 |
| Antigen | ZNF778 |
| Gene Symbols | ZNF778 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 49 kDa |
| Gene Alias | FLJ31875, MGC150573, zinc finger protein 778 |
| Gene ID (Entrez) | 197320 |
| Immunogen | Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_689569 |
| Antigen | ZNF491 |
| Gene Symbols | ZNF491 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 51 kDa |
| Gene Alias | FLJ34791, MGC126639, zinc finger protein 491 |
| Gene ID (Entrez) | 126069 |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_783729 |
| Antigen | SSX5 |
| Gene Symbols | SSX5 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 22 kDa |
| Gene Alias | MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5 |
| Gene ID (Entrez) | 6758 |
| Immunogen | The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |