Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (12)
- (1)
- (1)
- (2)
- (16)
- (4)
- (1)
- (16)
- (1)
- (17)
Form
- (13)
- (1)
Recombinant
- (14)
Species
- (2)
- (12)
Conjugate
- (2)
Keyword Search:
system mopping
Clear all selections
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
12
of
12
results
| Accession Number | Q15116 |
|---|---|
| Regulatory Status | RUO |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Gene ID (Entrez) | 5133 |
| Gene Symbol | Pdcd1 |
| Source | HEK293 cells |
| Recombinant | Recombinant |
| Name | Human PD-1 His-tag |
Abnova™ Human FLJ10808 Full-length ORF (AAH31637, 1 a.a. - 389 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Form | Liquid |
|---|---|
| Common Name | UBA6 |
| Molecular Weight (g/mol) | 68.31kDa |
| Gene Symbol | UBA6 |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Expression System | wheat germ expression system |
| For Use With (Application) | Antibody Production,Protein Array,ELISA,Western Blot |
| Name | FLJ10808 (Human) Recombinant Protein (P01) |
| Accession Number | AAH31637 |
| Regulatory Status | RUO |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Gene Alias | FLJ10808/FLJ23367/MOP-4/UBE1L2 |
| Gene ID (Entrez) | 55236 |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Immunogen | MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Protein Tag | GST |
| Species | Wheat Germ (in vitro) |
| Recombinant | Recombinant |
Abnova™ Human FLJ10808 Full-length ORF (AAH31637.1, 1 a.a. - 389 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Form | Liquid |
|---|---|
| Common Name | UBA6 |
| Molecular Weight (g/mol) | 69.6kDa |
| Gene Symbol | UBA6 |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Expression System | wheat germ expression system |
| For Use With (Application) | Antibody Production,Protein Array,ELISA,Western Blot |
| Name | FLJ10808 (Human) Recombinant Protein (P02) |
| Accession Number | AAH31637.1 |
| Regulatory Status | RUO |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Gene Alias | FLJ10808/FLJ23367/MOP-4/UBE1L2 |
| Gene ID (Entrez) | 55236 |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Immunogen | MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Protein Tag | GST |
| Species | Wheat Germ (in vitro) |
| Recombinant | Recombinant |
Abnova™ Human SAMHD1 Full-length ORF (NP_056289.2, 1 a.a. - 626 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Form | Liquid |
|---|---|
| Common Name | SAMHD1 |
| Molecular Weight (g/mol) | 98.6kDa |
| Gene Symbol | SAMHD1 |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Expression System | wheat germ expression system |
| For Use With (Application) | Antibody Production,Protein Array,ELISA,Western Blot |
| Name | SAMHD1 (Human) Recombinant Protein (P01) |
| Accession Number | NP_056289.2 |
| Regulatory Status | RUO |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Gene Alias | DCIP/HDDC1/MOP-5/SBBI88 |
| Gene ID (Entrez) | 25939 |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Immunogen | MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Protein Tag | GST |
| Species | Wheat Germ (in vitro) |
| Recombinant | Recombinant |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Gene Alias | LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1 |
| Molecular Weight (g/mol) | MolecularWeight-theroretical: 31.24 kDa |
| Gene ID (Entrez) | 9056 |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Gene Symbol | SLC7A7 |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
| Protein | SLC7A7 |
Abnova™ Human FLJ10808 Partial ORF (NP_060697, 962 a.a. - 1051 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Form | Liquid |
|---|---|
| Common Name | UBA6 |
| Molecular Weight (g/mol) | 35.64kDa |
| Gene Symbol | UBA6 |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Expression System | wheat germ expression system |
| For Use With (Application) | Antibody Production,ELISA,Protein Array,Western Blot |
| Name | FLJ10808 (Human) Recombinant Protein (Q01) |
| Accession Number | NP_060697 |
| Regulatory Status | RUO |
| Gene Alias | FLJ10808/FLJ23367/MOP-4/UBE1L2 |
| Gene ID (Entrez) | 55236 |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Immunogen | GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Protein Tag | GST |
| Species | Wheat Germ (in vitro) |
| Recombinant | Recombinant |
Abnova™ Human SLC7A7 Partial ORF (NP_003973.2, 462 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
| Form | Liquid |
|---|---|
| Common Name | SLC7A7 |
| Molecular Weight (g/mol) | 31.24kDa |
| Gene Symbol | SLC7A7 |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Expression System | wheat germ expression system |
| For Use With (Application) | Antibody Production,ELISA,Protein Array,Western Blot |
| Name | SLC7A7 (Human) Recombinant Protein (Q01) |
| Accession Number | NP_003973.2 |
| Regulatory Status | RUO |
| Gene Alias | LAT3/LPI/MOP-2/Y+LAT1/y+LAT-1 |
| Gene ID (Entrez) | 9056 |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Immunogen | RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Protein Tag | GST |
| Species | Wheat Germ (in vitro) |
| Recombinant | Recombinant |
Abnova™ Human SLC7A7 Full-length ORF (AAH03062.1, 1 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Abnova™ Human SLC7A7 Full-length ORF (AAH03062, 1 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re