missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC7A7 (aa 3-35) Control Fragment Recombinant Protein

Product Code. 30194030
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30194030 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194030 Supplier Invitrogen™ Supplier No. RP95664

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57574 (PA5-57574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UM01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9056
Name Human SLC7A7 (aa 3-35) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI790233; amino acid transporter SLC7A7 y+LAT1; LAT3; LPI; monocyte amino acid permease 2; MOP-2; my+lat1; Slc7a7; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; solute carrier family 7 member 7; y(+)L-type amino acid transporter 1; Y+L amino acid transporter 1; Y+L amino acid transporter 1; solute carrier family 7 member 7; y+LAT1; y+LAT-1
Common Name SLC7A7
Gene Symbol SLC7A7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.