missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF491 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
4465.00 NOK
Specifications
| Antigen | ZNF491 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF491 Polyclonal specifically detects ZNF491 in Human samples. It is validated for Western Blot.Specifications
| ZNF491 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ34791, MGC126639, zinc finger protein 491 | |
| ZNF491 | |
| IgG | |
| 51 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_689569 | |
| 126069 | |
| Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title