missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XK X-linked Kx blood group Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93011-0.1ml
This item is not returnable.
View return policy
Description
XK X-linked Kx blood group Polyclonal antibody specifically detects XK X-linked Kx blood group in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| XK X-linked Kx blood group | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, KX, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1). HRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSR | |
| 0.1 mL | |
| Neuroscience | |
| 7504 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction