missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TLE4 Polyclonal antibody specifically detects TLE4 in Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | TLE4 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | FITC |
| Formulation | PBS |
| Gene Alias | BCE1, BCE-1, E(spI), ESG4, homolog of Drosophila E(sp1), KIAA1261, Protein BCE-1, transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila), transducin-like enhancer protein 4 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 173-243 of human TLE4 (NP_001269677).,, Sequence:, SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?