missing translation for 'onlineSavingsMsg'
Learn More

TIA1 Antibody [DyLight 680], Novus Biologicals Biologicals™

Product Code. 30498206 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498206 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498206 Supplier Novus Biologicals Supplier No. NBP335245FR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TIA1 Polyclonal antibody specifically detects TIA1 in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIA1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 680
Formulation 50mM Sodium Borate
Gene Alias cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).,, Sequence:, IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 7072
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.