missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. tescalcin Antibody - Azide and BSA Free, R&D Systems™

tescalcin Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18615490 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18615490 0.02 mL 0.02mL
18619920 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18615490 Supplier Novus Biologicals Supplier No. NBP2938190.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

tescalcin Polyclonal antibody specifically detects tescalcin in Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen tescalcin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias calcineurin B homologous protein 3, CHP3, TSC
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-214 of human TESC (NP_060369.3). YRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54997
Target Species Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.