missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15975695

Invitrogen™ Talin 2 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15975695
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
Product Code. Quantity unitSize
15975695 100 μg 100µg
1 options
This item is not returnable. View return policy

Product Code. 15975695

Brand: Invitrogen™ PA580134

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse cardiac muscle tissue, SMMC7721 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue.

This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. This protein has a different pattern of expression compared to talin 1 but, like talin 1, is thought to associate with unique transmembrane receptors to form novel linkages between extracellular matrices and the actin cytoskeleton.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Talin 2
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Tln2
Gene Accession No. Q71LX4, Q9Y4G6
Gene Alias 5730421P04Rik; AI507121; AI787438; AL118320; ILWEQ; KIAA0320; mKIAA0320; RGD1565416; talin 2; talin-2; TLN2
Gene Symbols Tln2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 315776, 70549, 83660
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.