missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SUB1 (Human) Recombinant Protein

Human SUB1 partial ORF ( AAH09610.1, 32 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00010923-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195862

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV
Specifications

Specifications

AAH09610.1
SUB1 homolog (S. cerevisiae)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SUB1
GST
10923
Wheat germ expression system
25 μg
MGC102747, P15, PC4, p14
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers