missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498700

SPC25 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30498700 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498700 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498700 Supplier Novus Biologicals Supplier No. NBP335159AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Rabbit Polyclonal Antibody

SPC25 Polyclonal antibody specifically detects SPC25 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen SPC25
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias AD024, hSpc25, kinetochore protein Spc25, MGC22228,2600017H08Rik, SPBC25, SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae), spindle pole body component 25 homolog, spindle pole body component 25 homolog (S. cerevisiae)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-224 of human SPC25 (NP_065726.1).,, Sequence:, ANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57405
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.