missing translation for 'onlineSavingsMsg'
Learn More

SOD1 Recombinant Protein, Abnova

Human SOD1 full-length ORF (AAH01034, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal

Brand:  Abnova H00006647-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140902

  • 5420.23 NOK / 25µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. The encoded isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein.

  • Molecular weight: 42.68kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
  • Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue

Sequence:
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH01034
Solution
6647
SOD1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SOD1
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
42.68
8
Glutathione Sepharose 4 Fast Flow
25 ug
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
ALS/ALS1/IPOA/SOD/homodimer
SOD1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates