missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Smad5 Antibody (3A10), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00004090-M03
This item is not returnable.
View return policy
Description
Smad5 Monoclonal antibody specifically detects Smad5 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Smad5 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5 | |
| SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN | |
| 0.1 mg | |
| Signal Transduction | |
| 4090 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 3A10 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| AAH09682 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |