missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLFN12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
4300.00 NOK
Specifications
| Antigen | SLFN12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLFN12 Polyclonal specifically detects SLFN12 in Human samples. It is validated for Western Blot.Specifications
| SLFN12 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55106 | |
| Synthetic peptides corresponding to SLFN12(schlafen family member 12) The peptide sequence was selected from the middle region of SLFN12. Peptide sequence KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| schlafen family member 12 | |
| SLFN12 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title