missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC6A14 Antibody - Azide and BSA Free, Novus Biologicals™

SLC6A14 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18629820 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
Product Code. Quantity unitSize
18629820 0.02 mL 0.02mL
18637100 0.1 mL 0.1mL
2 options
This item is not returnable. View return policy

Product Code. 18629820

Brand: Novus Biologicals NBP2932470.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC6A14 Polyclonal antibody specifically detects SLC6A14 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC6A14
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Amino acid transporter ATB0+, amino acid transporter B0+, BMIQ11, OBX, sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), solute carrier family 6 (amino acid transporter), member 14, solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 member 14
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1). YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 11254
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.