missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SLC27A4 Recombinant Protein

Name: Abnova&trade; SLC27A4 Recombinant Protein
Brand: Abnova&trade;
SKU: 16125992
Price: 5540.00 EUR

Brand: Abnova™ H00010999-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16125992

Estimated Shipment: 19-05-2023
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH09959.1
Format	Solution
Gene ID (Entrez)	10999
Name	SLC27A4 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SLC27A4
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	51.8
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Gene Alias	ACSVL4/FATP4
Gene Symbol	SLC27A4
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description