missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500626

SGLT1/SLC5A1 Antibody [PE], Novus Biologicals Biologicals™

Product Code. 30500626 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500626 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500626 Supplier Novus Biologicals Supplier No. NBP335198PE

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SGLT1/SLC5A1 Polyclonal antibody specifically detects SGLT1/SLC5A1 in Human samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SGLT1/SLC5A1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate PE
Formulation PBS
Gene Alias D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human SGLT1/SLC5A1 (NP_000334.1).,, Sequence:, ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 6523
Target Species Human
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.